PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01027166001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ARF
Protein Properties Length: 608aa    MW: 67989 Da    PI: 6.7899
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01027166001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.61.1e-23125225198
                        EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                        f+k+lt sd++++g +++ +k+a+e+     +++ + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   + 
  GSVIVT01027166001 125 FCKILTASDTSTHGGFSVLRKHANEClppldMSQATPTQELVARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--RG 214
                        99****************************9555566679************************************************..34 PP

                        SEE..EEEEE- CS
                 B3  88 sefelvvkvfr 98 
                        +++el+v+v+r
  GSVIVT01027166001 215 DNGELRVGVRR 225
                        89999****98 PP

2Auxin_resp104.99.7e-35251330183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        a+ha++t++ F v+Y+Pr+  s+F+++++k+++a++  ++vGmRfkm+fe+eds+err++Gt+vg+ d++p +W+nSkWrsLk
  GSVIVT01027166001 251 ASHAVTTQTLFVVYYKPRT--SQFIISLNKYLEAVNYGFAVGMRFKMRFEGEDSPERRFTGTIVGIGDISP-QWSNSKWRSLK 330
                        689***************6..9***********************************************99.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.1E-41115240IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-41116254IPR015300DNA-binding pseudobarrel domain
CDDcd100174.68E-21123225No hitNo description
SMARTSM010192.0E-22125227IPR003340B3 DNA binding domain
PfamPF023621.2E-21125225IPR003340B3 DNA binding domain
PROSITE profilePS5086312.196125227IPR003340B3 DNA binding domain
PfamPF065073.3E-32251330IPR010525Auxin response factor
PfamPF023098.0E-8468528IPR033389AUX/IAA domain
SuperFamilySSF542775.0E-12490568No hitNo description
PROSITE profilePS5174527.684492584IPR000270PB1 domain
PfamPF023095.9E-7538582IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MAHGNNIRGG LEPGLESDHL FTELWRACAG PLVDVPKPHE RVFYFPQGHM EQLQASTNQG  60
VDQRIPLFNL PSKILCRVVH TRLLAEQETD EVYAQITLQP EADQTEPKSP DSCPDEAPKQ  120
TVHSFCKILT ASDTSTHGGF SVLRKHANEC LPPLDMSQAT PTQELVARDL HGYEWRFKHI  180
FRGQPRRHLL TTGWSTFVTS KRLVAGDAFV FLRGDNGELR VGVRRLARQQ SPMPSSVISS  240
QSMHLGVLAT ASHAVTTQTL FVVYYKPRTS QFIISLNKYL EAVNYGFAVG MRFKMRFEGE  300
DSPERRFTGT IVGIGDISPQ WSNSKWRSLK IQWDEPATIQ RPERVSSWDI EPFVASASLN  360
LTQPPVKIKR PRPLDLPVAE NTSSSVPSPF WYAGSSPSHE LTQLGGVTEV QSSESQVHWP  420
PKPKEINGNQ NSSIGCRLFG IDLTNNSKAT ALLEMIQNLD VSKSSNEQKQ VVPEASQKET  480
QGRQSCTPSS RTRTKKVQMQ GVAVGRAVDL TALEGYDELI SELEKMFEIK GELCPRNKWE  540
VVFTDDEGDM MLVGDDPWQE FCKMVRKIFI YSSEEVKKMS PRCKLSTSSL DGEGTVISLD  600
SELRTEP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-17543533355Auxin response factor 1
4ldw_A1e-17543533355Auxin response factor 1
4ldw_B1e-17543533355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1368372KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.56700.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4672891e-134AM467289.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X170449.20, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661956.10.0PREDICTED: auxin response factor 18
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLF6I6F30.0F6I6F3_VITVI; Auxin response factor
STRINGVIT_15s0046g00290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.10.0auxin response factor 11